General Information

  • ID:  hor006582
  • Uniprot ID:  Q3SAF3
  • Protein name:  natriuretic peptide PaNP-c
  • Gene name:  NA
  • Organism:  Pseudechis australis (Mulga snake) (King brown snake)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Pseudechis (genus), Acanthophiinae (subfamily), Elapidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0004857 enzyme inhibitor activity; GO:0005179 hormone activity; GO:0008191 metalloendopeptidase inhibitor activity; GO:0030414 peptidase inhibitor activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SGSKTAEIGDGCFGVPIDHIGSTSGMGCGRPRPKPTPGGS
  • Length:  40(1-40)
  • Propeptide:  SGSKTAEIGDGCFGVPIDHIGSTSGMGCGRPRPKPTPGGS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Snake venom natriuretic peptide that exhibits hypotensive and vasodepressor activity (By similarity). Recombinant PaNP-c inhibits the angiotensin converting enzyme (ACE).
  • Mechanism:  Negative results: recombinant PaNP-c does not demonstrate any stimulation of cGMP production via the natriuretic peptide receptor-A (NPR1) and does not inhibit platelet aggregation.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  46019
  • Structure ID:  AF-Q3SAF3-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q3SAF3-F1.pdbhor006582_AF2.pdbhor006582_ESM.pdb

Physical Information

Mass: 456812 Formula: C161H260N50O55S3
Absent amino acids: LNQWY Common amino acids: G
pI: 8.24 Basic residues: 5
Polar residues: 20 Hydrophobic residues: 6
Hydrophobicity: -48.5 Boman Index: -5666
Half-Life / Aliphatic Index: 1.9 hour Aliphatic Index: 39
Instability Index: 3931 Extinction Coefficient cystines: 125
Absorbance 280nm: 3.21

Literature

  • PubMed ID:  16908092
  • Title:  Cloning and characterisation of natriuretic peptides from the venom glands of Australian elapids.